Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Neuronal PAS Domain Protein 1 (NPAS1) antibody

Antigen

Neuronal PAS Domain Protein 1 (NPAS1)

Synonyms MOP5, PASD5, bHLHe11, si:dkeyp-13e2.1
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN182486
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name NPAS1
Gene ID NPAS1
UniProt Q99742
Immunogen The immunogen for anti-NPAS1 antibody: synthetic peptide directed towards the C terminal of human NPAS1
Sequence TIRYGPAELGLVYPHLQRLGPGPALPEAFYPPLGLPYPGP AGTRLPRKGD
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-NPAS1 antibody concentration is 1 mg/ml.
Description NPAS1 is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. Studies of a related mouse gene suggest that it functions in neurons. The exact function of this gene is unclear, but it may play protective or modulatory roles during late embryogenesis and postnatal development.
Characteristics Antigen Size: 590 amino acids
Molecular Weight 63kDa

Application Details

Application Notes WB Suggested Anti-NPAS1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Hogenesch, Chan, Jackiw et al.: "Characterization of a subset of the basic-helix-loop-helix-PAS superfamily that interacts with components of the dioxin signaling pathway." in: The Journal of biological chemistry, Vol. 272, Issue 13, pp. 8581-93, 1997 (PubMed).

Alternatives

Alternatives for antigen "Neuronal PAS Domain Protein 1 (NPAS1)", type "Antibodies"
Hosts Rabbit (33)
Reactivities Human (31), Mouse (Murine) (25), Rat (Rattus) (23), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1)
Applications Western Blotting (WB) (18), Immunofluorescence (IF) (16), ELISA (13), Immunohistochemistry (IHC) (7), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes C-Term (4), Internal Region (2), Center (1)