GS Homeobox 2 (GSX2) antibody

Antigen: GS Homeobox 2 (GSX2)

Synonyms: Gsh2, Gsh-2, GSH2, gsh2, zgc:136270, si:dkey-97c6.1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN182507

Additional Information

Alternative name: GS homeobox 2 / GSH2

Gene ID: GSH2

UniProt: Q9BZM3

Immunogen: The immunogen for anti-GSH2 antibody: synthetic peptide directed towards the N terminal of human GSH2

Sequence: MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPP LVMSVSGPGC

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-GSH2 antibody concentration is 1 mg/ml.

Description: Homeobox protein GSH-2

Characteristics: Antigen Size: 304 amino acids

Molecular Weight: 32kDa

Application Details

Application Notes: WB Suggested Anti-GSH2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver.
Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 5µg/ml using anti-GSH2 antibody (ABIN182507).

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-GSH2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver

Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 5µg/ml using anti-GSH2 antibody (ARP32208_P050)

Publications

Product: Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).