Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Sirtuin 6 (SIRT6) antibody

Antigen

Sirtuin 6 (SIRT6)
Synonyms Sir2l6, AI043036, 2810449N18Rik, SIR2L6, MGC114368, SIRT6
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Dog (Canine), Mouse (Murine), Rat (Rattus), Pig (Porcine), Chicken, Xenopus laevis
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182566
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Sirtuin 6 (SIRT6) antibody

anti-Sirtuin 6 (SIRT6) antibody (2)

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name SIRT6
Gene ID SIRT6
UniProt Q8N6T7
Immunogen The immunogen for anti-SIRT6 antibody: synthetic peptide directed towards the N terminal of human SIRT6
Sequence STASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTH MALVQLERVG
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-SIRT6 antibody concentration is 1 mg/ml.
Description SIRT6 encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by SIRT6 is included in class IV of the sirtuin family.
Characteristics Antigen Size: 355 amino acids
Molecular Weight 39kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-SIRT6 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cancer
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Frye: "Phylogenetic classification of prokaryotic and eukaryotic Sir2-like proteins." in: Biochemical and biophysical research communications, Vol. 273, Issue 2, pp. 793-8, 2000 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Sirtuin 6 (SIRT6)", type "Antibodies"
Hosts Rabbit (49), Mouse (4), Chicken (3)
Reactivities Human (50), Rat (Rattus) (24), Mouse (Murine) (22), Dog (Canine) (2), Cow (Bovine) (1)
Applications Western Blotting (WB) (30), Immunofluorescence (IF) (24), ELISA (23), Immunohistochemistry (IHC) (12), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (10), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoprecipitation (IP) (2), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Biotin (4), Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), FITC (2), PE,Cy5.5 (2), Alexa Flour 488 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy7 (1)
Epitopes C-Term (9), pSer338 (4), AA 305-320 (1), C-Term,pTyr526,pTyr527 (1), Internal Region (1), N-Term (1), pThr202 (1)