Forkhead Box N3 (FOXN3) (C-Term) antibody

Details for Product No. ABIN182688
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms CHES1, PRO1635, C14orf116, 5430426H20Rik, AA589593, AW556347, Ches1, Ches1l, HTLFL1, ches1, foxn3, foxn3a, FOXN3, pro1635, zgc:136571, foxn3b
Epitope
C-Term
(3), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Pig (Porcine), Human, Zebrafish (Danio rerio), Chicken
(15), (2), (2), (2), (1), (1), (1), (1)
Host
Rabbit
(11), (4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(12), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN182688
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human CHES1
Sequence SGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDE EMKEAAGSLL
Predicted Reactivity Western clawed frog :100 %,   African clawed frog :100 %,   Rat :100 %,   Chicken :100 %,   Pig :100 %,   Mouse :100 %,   Human :100 %,   Green puffer :70 %,  
Characteristics This is a rabbit polyclonal antibody against CHES1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name CHES1
Background Checkpoint suppressor 1 is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, rad53 and dun1 by activating a MEC1-independent checkpoint pathway.
Molecular Weight 52 kDa
Gene ID 1112
NCBI Accession NM_005197, NP_005188
UniProt O00409
Research Area Chromatin and Nuclear Signaling, Cell Cycle, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 468 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Forkhead Box N3 (FOXN3) (C-Term) antibody WB Suggested Anti-CHES1 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
Background publications Yu, Zhang, Zhou et al.: "Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs." in: Genome research, Vol. 11, Issue 8, pp. 1392-403, 2001 (PubMed).

Hosts (11), (4)
Reactivities (15), (2), (2), (2), (1), (1), (1), (1)
Applications (12), (2), (2), (1), (1)
Epitopes (3), (2), (2), (1), (1)
back to top