Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182688

Forkhead Box N3 (FOXN3) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CHES1, PRO1635, C14orf116, 5430426H20Rik, AA589593, AW556347, Ches1, Ches1l, HTLFL1, ches1, foxn3, foxn3a, FOXN3, pro1635, zgc:136571, foxn3b
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Pig (Porcine), Human, Zebrafish (Danio rerio), Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182688
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CHES1 antibody: synthetic peptide directed towards the C terminal of human CHES1
Sequence SGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDE EMKEAAGSLL
Predicted Reactivity Western clawed frog :100%,   African clawed frog :100%,   Rat :100%,   Chicken :100%,   Pig :100%,   Mouse :100%,   Human :100%,   Green puffer :75%,  
Characteristics This is a rabbit polyclonal antibody against CHES1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name CHES1
Background Checkpoint suppressor 1 is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, rad53 and dun1 by activating a MEC1-independent checkpoint pathway.
Molecular Weight 52kDa
Gene ID 1112
NCBI Accession NP_005188, NM_005197
UniProt O00409
Research Area Chromatin and Nuclear Signaling, Cell Cycle, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CHES1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Yu, Zhang, Zhou et al.: "Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs." in: Genome research, Vol. 11, Issue 8, pp. 1392-403, 2001 (PubMed).

Alternatives for antigen "Forkhead Box N3 (FOXN3)", type "Antibodies"
Hosts (13), (4)
Reactivities (17), (2), (2), (2), (1), (1), (1), (1)
Applications (14), (3), (2), (1), (1)
Epitopes (5), (2), (2), (1), (1), (1)
Beacon