Forkhead Box N3 (FOXN3) antibody

Antigen: Forkhead Box N3 (FOXN3)

Synonyms: CHES1, PRO1635, C14orf116, Ches1, Ches1l, HTLFL1, AA589593, AW556347, MGC36260, MGC107530, 5430426H20Rik, FOXN3, ches1, pro1635, MGC146956, zgc:136571, foxn3b

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Xenopus laevis, Chicken, Pig (Porcine)

Application: Western Blotting (WB)

Catalog no.: ABIN182688

Additional Information

Alternative name: FOXN3 / CHES1

Gene ID: CHES1

UniProt: O00409

Immunogen: The immunogen for anti-CHES1 antibody: synthetic peptide directed towards the C terminal of human CHES1

Sequence: SGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDE EMKEAAGSLL

Cross-Reactivity: Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-CHES1 antibody concentration is 1 mg/ml.

Description: Checkpoint suppressor 1 is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, rad53 and dun1 by activating a MEC1-independent checkpoint pathway.

Characteristics: Antigen Size: 468 amino acids

Molecular Weight: 52kDa

Application Details

Application Notes: WB Suggested Anti-CHES1 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-CHES1 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Yu, Zhang, Zhou et al.: "Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs." in: Genome research, Vol. 11, Issue 8, pp. 1392-403, 2001 (PubMed).