T-Box 20 (TBX20) antibody
| Antigen | T-Box 20 (TBX20) |
| Synonyms | ASD4, Tbx12, AL022859, 9430010M06Rik, hrt, cb826, ZF-TBX20, tbx20-A, XTBX20, TBX20, tbx20 |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Reactivity |
Alternatives Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Chicken, Xenopus laevis |
| Application |
Alternatives Western Blotting (WB), Immunohistochemistry (IHC) |
 |
1 reference available |
| Catalog no. | ABIN182755 |
| Quantity | 50 µg (Variants) |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | TBX20 |
| Gene ID | TBX20 |
| Immunogen | The immunogen for anti-TBX20 antibody: synthetic peptide directed towards the N terminal of human TBX20 |
| Sequence | MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIK PLEQFVEKSS |
| Cross-Reactivity | Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-TBX20 antibody concentration is 1 mg/ml. |
| Description | TBX20 is a member of the T-box transcription factor family expressed in the developing heart, eye, ventral neural tube, and limbs, indicating a possible role in regulating development of these tissues. |
| Characteristics | Antigen Size: 297 amino acids |
| Molecular Weight | 33kDa |
Application Details
| Application Notes |
WB Suggested Anti-TBX20 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate. |
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Restrictions | For Research Use only |
Images
|
WB Suggested Anti-TBX20 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate anti-T-Box 20 (TBX20) antibody (Image 2) anti-T-Box 20 (TBX20) antibody (Image 3) |
Publications
| Product |
Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).
|
Alternatives
Alternatives for antigen "T-Box 20 (TBX20)", type "Antibodies"
| Hosts | Rabbit (4) |
| Reactivities | Human (4), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1), Mouse (Murine) (1), Rat (Rattus) (1), Xenopus laevis (1), Zebrafish (1) |
| Applications | Western Blotting (WB) (4), ELISA (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1) |
| Epitopes | C-Term,AA 307-335 (1), Internal Region (1), N-Term (1) |
