Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Jumonji Domain Containing 5 (JMJD5) antibody

Antigen

Jumonji Domain Containing 5 (JMJD5)
Synonyms FLJ13798, MGC173863, zgc:91962, zgc:173863
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182843
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Jumonji Domain Containing 5 (JMJD5) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name JMJD5
Gene ID FLJ13798
UniProt Q9H8B1
Immunogen The immunogen for anti-FLJ13798 antibody: synthetic peptide directed towards the C terminal of human FLJ13798
Sequence YPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPG EILFIPVKYW
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-FLJ13798 antibody concentration is 1 mg/ml.
Description The FLJ13798 gene, located on chromosome 16, encodes a hypothetical protein with unknown function.
Characteristics Antigen Size: 416 amino acids
Molecular Weight 47kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-FLJ13798 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Jumonji Domain Containing 5 (JMJD5)", type "Antibodies"
Hosts Rabbit (34)
Reactivities Human (34), Mouse (Murine) (23), Rat (Rattus) (21), Cow (Bovine) (19), Dog (Canine) (1), Zebrafish (1)
Applications Western Blotting (WB) (19), Immunofluorescence (IF) (14), ELISA (13), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (IHC) (2), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (5), N-Term (2), Internal Region (1)