Claudin 10 (CLDN10) antibody

Antigen: Claudin 10 (CLDN10)

Synonyms: OSP-L, CPETRL3, Cldn10, Cldn10b, D14Ertd728e, 6720456I16Rik, dZ52I16.3, si:dz52i16.3, si:busm1-52i16.3, CLDN10, MGC179447, DKFZp469F1626

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN182848

Additional Information

Alternative name: Claudin-10 / CLDN10

Gene ID: CLDN10

UniProt: P78369

Immunogen: The immunogen for anti-CLDN10 antibody: synthetic peptide directed towards the C terminal of human CLDN10

Sequence: MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVI TTATYWANLW

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-CLDN10 antibody concentration is 1 mg/ml.

Description: CLDN10 encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets.

Characteristics: Antigen Size: 228 amino acids

Molecular Weight: 24kDa

Application Details

Application Notes: WB Suggested Anti-CLDN10 Antibody Titration: 2.5ug/ml
Positive Control: Daudi cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-CLDN10 Antibody Titration: 2.5ug/ml
Positive Control: Daudi cell lysate

Publications

Gonzualez-Mariscal, Betanzos, Nava et al.: "Tight junction proteins." in: Progress in biophysics and molecular biology, Vol. 81, Issue 1, pp. Jan 44, 2002 (PubMed).