Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16) antibody

Antigen: Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16)

Synonyms: LRRGT00109, RGD1306243, PARP16, MGC142706, C15orf30, FLJ20509, FLJ25281, C79952, BC055447, MGC65335, MGC77744

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN182872

Additional Information

Alternative name: PARP16

Gene ID: PARP16

UniProt: Q6PK64

Immunogen: The immunogen for anti-PARP16 antibody: synthetic peptide directed towards the N terminal of human PARP16

Sequence: KRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQS SGDNHKRAWD

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PARP16 antibody concentration is 1 mg/ml.

Description: Poly(ADP-ribosyl)ation is an immediate DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells. PARP16 is a member of poly(ADP-ribose) polymerases (PARPs) family that is encoded by different genes and displaying a conserved catalytic domain in which PARP-1 (113 kDa), the founding member, and PARP-2 (62 kDa) are so far the sole enzymes whose catalytic activity has been shown to be immediately stimulated by DNA strand breaks. A large repertoire of sequences encoding novel PARPs now extends considerably the field of poly(ADP-ribosyl)ation reactions to various aspects of the cell biology including cell proliferation and cell death. Some of these new members interact with each other, share common partners and common subcellular localizations suggesting possible fine tuning in the regulation of this post-translational modification of proteins.

Characteristics: Antigen Size: 323 amino acids

Molecular Weight: 36kDa

Application Details

Application Notes: WB Suggested Anti-PARP16 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human kidney.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-PARP16 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human kidney

Publications

Product: Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).