Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6) (N-Term) antibody

Details for Product No. ABIN182876
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms ARTD17, PARP-6-B1, PARP-6-C, pART17, 1700119G14Rik, 2310028P13Rik, 3110038K10Rik, C030013N01Rik, PARP-6, RGD1310937
Epitope
N-Term
(7), (3), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human
(17), (3), (3), (1)
Host
Rabbit
(19)
Clonality
Polyclonal
Application
Western Blotting (WB)
(19), (6), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN182876
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PARP6
Sequence HINISFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPEP SIEVFQPSNK
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against PARP6. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name PARP6
Background Poly(ADP-ribose) polymerases (PARPs) constitute a large family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain. They are involved in DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells.
Molecular Weight 59 kDa
Gene ID 56965
NCBI Accession NM_020214, NP_064599
UniProt Q9HAF3
Research Area Chromatin and Nuclear Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 519 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6) (N-Term) antibody WB Suggested Anti-PARP6 Antibody Titration: 1.25ug/ml
Positive Control: Daudi cell lysate
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (19)
Reactivities (17), (3), (3), (1)
Applications (19), (6), (2), (1)
Epitopes (7), (3), (2)
back to top