Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182876

Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ARTD17, PARP-6-B1, PARP-6-C, pART17, 1700119G14Rik, 2310028P13Rik, 3110038K10Rik, C030013N01Rik, PARP-6, RGD1310937
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182876
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PARP6 antibody: synthetic peptide directed towards the N terminal of human PARP6
Sequence HINISFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPEP SIEVFQPSNK
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against PARP6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name PARP6
Background Poly(ADP-ribose) polymerases (PARPs) constitute a large family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain. They are involved in DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells.
Molecular Weight 59kDa
Gene ID 56965
NCBI Accession NP_064599, NM_020214
UniProt Q9HAF3
Research Area Chromatin and Nuclear Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PARP6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6)", type "Antibodies"
Hosts (23)
Reactivities (21), (3), (3), (1)
Applications (23), (6), (2), (1)
Epitopes (12), (3), (2), (2), (2)
Beacon