Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6) antibody

Antigen

Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6)

Synonyms MGC131971, 1700119G14Rik, 2310028P13Rik, 3110038K10Rik, C030013N01Rik, RGD1310937, PARP6, MGC166370, DKFZp459B2362
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182876
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name PARP6
Gene ID PARP6
UniProt Q9HAF3
Immunogen The immunogen for anti-PARP6 antibody: synthetic peptide directed towards the N terminal of human PARP6
Sequence HINISFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPEP SIEVFQPSNK
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-PARP6 antibody concentration is 1 mg/ml.
Description Poly(ADP-ribose) polymerases (PARPs) constitute a large family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain. They are involved in DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells.
Characteristics Antigen Size: 519 amino acids
Molecular Weight 59kDa

Application Details

Application Notes WB Suggested Anti-PARP6 Antibody Titration: 1.25ug/ml
Positive Control: Daudi cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling
Restrictions For Research Use only

Publications

Product Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives

Alternatives for antigen "Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6)", type "Antibodies"
Hosts Rabbit (16)
Reactivities Human (14), Dog (Canine) (3), Mouse (Murine) (3), Rat (Rattus) (3), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1)
Applications Western Blotting (WB) (16), ELISA (8), Immunohistochemistry (IHC) (3), Immunofluorescence (IF) (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1), Immunoprecipitation (IP) (1)
Epitopes C-Term (6), N-Term (3), C-Term, Tyr503 (1)