Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Tripartite Motif Containing 13 (TRIM13) antibody

Antigen

Tripartite Motif Containing 13 (TRIM13)

Synonyms CAR, LEU5, RFP2, DLEU5, RNF77, Rfp2, 3110001L12Rik, TRIM13, MGC134296
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182940
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name TRIM13 / RNF77
Gene ID RFP2
UniProt O60858
Immunogen The immunogen for anti-RFP2 antibody: synthetic peptide directed towards the middle region of human RFP2
Sequence KVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQAYDPEIN KLNTILQEQR
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-RFP2 antibody concentration is 1 mg/ml.
Description The protein encoded by RFP2 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies near the nucleus, but its function is unknown. RFP2 is located on chromosome 13 within the minimal deletion region for B-cell chronic lymphocytic leukemia.
Characteristics Antigen Size: 407 amino acids
Molecular Weight 45kDa

Application Details

Application Notes WB Suggested Anti-RFP2 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Matsuda, Suzuki, Honda et al.: "Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways." in: Oncogene, Vol. 22, Issue 21, pp. 3307-18, 2003 (PubMed).

Alternatives

Alternatives for antigen "Tripartite Motif Containing 13 (TRIM13)", type "Antibodies"
Hosts Rabbit (28), Mouse (1)
Reactivities Human (29), Mouse (Murine) (19), Rat (Rattus) (19), Dog (Canine) (17), Horse (Equine) (17), Pig (Porcine) (17), Sheep (Ovine) (17), Cow (Bovine) (2)
Applications Immunofluorescence (IF) (14), Western Blotting (WB) (13), ELISA (9), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (IHC) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (3), Internal Region (2)