Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

AT Rich Interactive Domain 3B (BRIGHT-Like) (ARID3B) antibody

Antigen

AT Rich Interactive Domain 3B (BRIGHT-Like) (ARID3B)

Synonyms BDP, DRIL2, Bdp, Dri2, MGC59291, ARID3B, MGC158235, wu:fc16g09, wu:fc87c02, zgc:158235
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Dog (Canine), Mouse (Murine), Rat (Rattus)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182966
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ARID3B
Gene ID ARID3B
UniProt O95443
Immunogen The immunogen for anti-ARID3B antibody: synthetic peptide directed towards the N terminal of human ARID3B
Sequence DPRVAPMSNLLPAPGLPPHGQQAKEDHTKDASKASPSVST AGQPNWNLDE
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-ARID3B antibody concentration is 1 mg/ml.
Description ARID3B is a member of the ARID (AT-rich interaction domain) family of DNA-binding proteins. The protein is homologous with two proteins that bind to the retinoblastoma gene product, and also with the mouse Bright and Drosophila dead ringer proteins. Members of the ARID family have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification. This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It is homologous with two proteins that bind to the retinoblastoma gene product and also with the mouse Bright and Drosophila dead ringer proteins. A pseudogene on chromosome 1p31 also exists for this gene. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.
Characteristics Antigen Size: 560 amino acids
Molecular Weight 61kDa

Application Details

Application Notes WB Suggested Anti-ARID3B Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Human Thymus.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Kortschak, Tucker, Saint: "ARID proteins come in from the desert." in: Trends in biochemical sciences, Vol. 25, Issue 6, pp. 294-9, 2000 (PubMed).

Alternatives

Alternatives for antigen "AT Rich Interactive Domain 3B (BRIGHT-Like) (ARID3B)", type "Antibodies"
Hosts Rabbit (13)
Reactivities Human (13), Cow (Bovine) (2), Dog (Canine) (2), Mouse (Murine) (2), Rat (Rattus) (2)
Applications Western Blotting (WB) (11), ELISA (6), Immunohistochemistry (IHC) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1)
Epitopes C-Term (5), N-Term (2), Center (1), Internal Region (1)