Transmembrane Protein 175 (TMEM175) antibody

Antigen: Transmembrane Protein 175 (TMEM175)

Synonyms: MGC4618, AI504381, 3010001K23Rik, RGD1309712, TMEM175, MGC128440, tmem175, si:ch211-168m18.2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN182985

Additional Information

Alternative name: TMEM175

Gene ID: MGC4618

UniProt: Q9BSA9

Immunogen: The immunogen for anti-MGC4618 antibody: synthetic peptide directed towards the N terminal of human MGC4618

Sequence: QRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRL LATRIAVYLM

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-MGC4618 antibody concentration is 1 mg/ml.

Description: The MGC4618 is a hypothetical protein found in Chromosome 4

Characteristics: Antigen Size: 504 amino acids

Molecular Weight: 56kDa

Application Details

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

anti-Transmembrane Protein 175 (TMEM175) antibody

Publications

Product: Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).