Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Polycomb Group Ring Finger 3 (PCGF3) antibody

Antigen

Polycomb Group Ring Finger 3 (PCGF3)
Synonyms RNF3, DONG1, RNF3A, FLJ36550, FLJ43813, MGC40413, MGC129615, DKFZp686D20235, Rnf3, AI662857, E430039C14, 2310035N15Rik, D630042K08Rik, rnf3, dong1, rnf3a, PCGF3, MGC129075
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183000
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Polycomb Group Ring Finger 3 (PCGF3) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name PCGF3 / RNF3
Gene ID PCGF3
UniProt Q3KNV8
Immunogen The immunogen for anti-PCGF3 antibody: synthetic peptide directed towards the middle region of human PCGF3
Sequence FYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNK EAAEEKPEED
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-PCGF3 antibody concentration is 1 mg/ml.
Description PCGF3 encodes a protein that contains a C3HC4 type RING finger, which is a motif known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined.
Characteristics Antigen Size: 242 amino acids
Molecular Weight 28kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-PCGF3 Antibody Titration: 0.125ug/ml
ELISA Titer: 1:12500
Positive Control: Raji cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Polycomb Group Ring Finger 3 (PCGF3)", type "Antibodies"
Hosts Rabbit (21), Goat (4), Mouse (1)
Reactivities Human (25), Cow (Bovine) (20), Mouse (Murine) (20), Rat (Rattus) (19), Dog (Canine) (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (9), ELISA (6), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Internal Region (2), AA 247 isoform (1), C-Term (1)