Zinc Finger, HIT-Type Containing 6 (ZNHIT6) antibody

Antigen: Zinc Finger, HIT-Type Containing 6 (ZNHIT6)

Synonyms: BCD1, C1orf181, FLJ20729, FLJ20760, NY-BR-75, MGC131963, 2410019A14Rik, RGD1308723, DKFZp469E0622, C3H1ORF181

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Chicken

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN183040

Additional Information

Alternative name: ZNHIT6

Gene ID: FLJ20729

UniProt: Q9NWN0

Immunogen: The immunogen for anti-FLJ20729 antibody: synthetic peptide directed towards the C terminal of human FLJ20729

Sequence: PISNKYMYFMKNRARRQGINLKLLPNGFTKRKENSTFFDK KKQQFCWHVK

Cross-Reactivity: Dog (Canine), Chicken, Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-FLJ20729 antibody concentration is 1 mg/ml.

Description: TRMT1 is a tRNA(m(2)(2)G(26))dimethyltransferase

Characteristics: Antigen Size: 470 amino acids

Molecular Weight: 54kDa

Application Details

Application Notes: WB Suggested Anti-FLJ20729 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-FLJ20729 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

anti-Zinc Finger, HIT-Type Containing 6 (ZNHIT6) antibody (Image 2)

Publications

Scanlan, Gout, Gordon et al.: "Humoral immunity to human breast cancer: antigen definition and quantitative analysis of mRNA expression." in: Cancer immunity : a journal of the Academy of Cancer Immunology, Vol. 1, pp. 4, 2003 (PubMed).