Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromobox Homolog 8 (CBX8) antibody

Antigen

Chromobox Homolog 8 (CBX8)

Synonyms PC3, RC1, HPC3, cbx8, MGC147589
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183046
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name CBX8
Gene ID CBX8
UniProt Q9HC52
Immunogen The immunogen for anti-CBX8 antibody: synthetic peptide directed towards the middle region of human CBX8
Sequence QCGVTSPSSAEATGKLAVDTFPARVIKHRAAFLEAKGQGA LDPNGTRVRH
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-CBX8 antibody concentration is 1 mg/ml.
Description CBX8 is one of the proteins homolog to the Polycomb group (PcG) proteins. They assemble to form large multiprotein complexes involved in gene silencing. Evidence suggests that PcG complexes are heterogeneous with respect to both protein composition and specific function.
Characteristics Antigen Size: 389 amino acids
Molecular Weight 43kDa

Application Details

Application Notes WB Suggested Anti-CBX8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Bárdos, Saurin, Tissot et al.: "HPC3 is a new human polycomb orthologue that interacts and associates with RING1 and Bmi1 and has transcriptional repression properties." in: The Journal of biological chemistry, Vol. 275, Issue 37, pp. 28785-92, 2000 (PubMed).

Alternatives

Alternatives for antigen "Chromobox Homolog 8 (CBX8)", type "Antibodies"
Hosts Rabbit (33), Goat (4)
Reactivities Human (35), Mouse (Murine) (22), Rat (Rattus) (20), Cow (Bovine) (2), Dog (Canine) (2), Xenopus laevis (2), Zebrafish (2), Chicken (1)
Applications Western Blotting (WB) (21), ELISA (15), Immunofluorescence (IF) (15), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoprecipitation (IP) (2), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (4), N-Term (3), Internal Region (2), Center (1), pThr229 (1)