Death Inducer-Obliterator 1 (DIDO1) antibody

Antigen: Death Inducer-Obliterator 1 (DIDO1)

Synonyms: BYE1, DIO1, DATF1, DIDO2, DIDO3, DIO-1, FLJ11265, KIAA0333, MGC16140, C20orf158, dJ885L7.8, DKFZp434P1115, Datf1, Dido2, Dido3, mKIAA0333, C530043I07, 6720461J16Rik, D130048F08Rik, DIDO1, MGC137821, datf1l, fi35b04, MGC158157, wu:fi35b04, zgc:158157, DKFZp469J1523, bye1, dio1, datf1, dido2, dido3, dio-1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN183106

Additional Information

Alternative name: DIDO1

Gene ID: DIDO1

UniProt: Q9BTC0-2

Immunogen: The immunogen for anti-DIDO1 antibody: synthetic peptide directed towards the N terminal of human DIDO1

Sequence: ERVEQFLTIARRRGRRSMPVSLEDSGEPTSCPATDAETAS EGSVESASET

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-DIDO1 antibody concentration is 1 mg/ml.

Description: In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. DIDO1 gene is similar to the mouse gene and therefore is thought to be involved in apoptosis.Apoptosis, a major form of cell death, is an efficient mechanism for eliminating unwanted cells and is of central importance for development and homeostasis in metazoan animals. In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. This gene is similar to the mouse gene and therefore is thought to be involved in apoptosis. Alternatively spliced transcripts have been found for this gene, encoding multiple isoforms.

Characteristics: Antigen Size: 544 amino acids

Molecular Weight: 59kDa

Synonyms: BYE1, DIO1, DATF1, DIDO2, DIDO3, DIO-1, FLJ11265, KIAA0333, MGC16140, C20orf158, dJ885L7.8, DKFZp434P1115, Datf1, Dido2, Dido3, mKIAA0333, C530043I07, 6720461J16Rik, D130048F08Rik, DIDO1, MGC137821, datf1l, fi35b04, MGC158157, wu:fi35b04, zgc:158157, DKFZp469J1523, bye1, dio1, datf1, dido2, dido3, dio-1

Application Details

Application Notes: WB Suggested Anti-DIDO1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-DIDO1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

Publications

Product: Fütterer, Campanero, Leonardo et al.: "Dido gene expression alterations are implicated in the induction of hematological myeloid neoplasms." in: The Journal of clinical investigation, Vol. 115, Issue 9, pp. 2351-62, 2005 (PubMed).