Cation Channel, Sperm Associated 2 (CATSPER2) antibody

Antigen: Cation Channel, Sperm Associated 2 (CATSPER2)

Synonyms: MGC33346, CATSPER2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN183176

Additional Information

Alternative name: CATSPER2

Gene ID: CATSPER2

UniProt: Q96P54

Immunogen: The immunogen for anti-CATSPER2 antibody: synthetic peptide directed towards the N terminal of human CATSPER2

Sequence: HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIK PQRIEQISHA

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-CATSPER2 antibody concentration is 1 mg/ml.

Description: Calcium ions play a primary role in the regulation of sperm motility. Anti-CATSPER2 belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. A second, closely linked copy of this gene has been identified. Although multiple transcript variants encoding protein isoforms have been characterized, they seem to be only transcribed from this gene. Additional splice variants have been described but their full-length nature has not been determined.

Characteristics: Antigen Size: 414 amino acids

Molecular Weight: 46kDa

Application Details

Application Notes: WB Suggested Anti-CATSPER2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-CATSPER2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

anti-Cation Channel, Sperm Associated 2 (CATSPER2) antibody (Image 2)

Publications

Product: Quill, Ren, Clapham et al.: "A voltage-gated ion channel expressed specifically in spermatozoa." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 98, Issue 22, pp. 12527-31, 2001 (PubMed).