Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Amiloride-Sensitive Cation Channel 4, Pituitary (ACCN4) antibody

Antigen

Amiloride-Sensitive Cation Channel 4, Pituitary (ACCN4)
Synonyms ASIC4, BNAC4, MGC17248, MGC24860, Asic4, Spasic, ACCN4
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Rabbit
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183191
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Amiloride-Sensitive Cation Channel 4, Pituitary (ACCN4) antibody

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name ASIC4 / ACCN4
Gene ID ACCN4
UniProt Q96FT7-2
Immunogen The immunogen for anti-ACCN4 antibody: synthetic peptide directed towards the N terminal of human ACCN4
Sequence SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAV APGAAPRDLA
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rabbit, Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ACCN4 antibody concentration is 1 mg/ml.
Description ACCN4 belongs to the superfamily of acid-sensing ion channels, which are proton-gated, amiloride-sensitive sodium channels. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. ACCN4 is predominantly expressed in the pituitary gland, and might be a candidate for paroxysmal dystonic choreoathetosis (PDC), a movement disorder.
Characteristics Antigen Size: 417 amino acids
Molecular Weight 46kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-ACCN4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:500
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Amiloride-Sensitive Cation Channel 4, Pituitary (ACCN4)", type "Antibodies"
Hosts Rabbit (36)
Reactivities Human (31), Mouse (Murine) (22), Rat (Rattus) (21), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1)
Applications Western Blotting (WB) (21), Immunofluorescence (IF) (16), ELISA (14), Immunohistochemistry (IHC) (4), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes N-Term (4), Internal Region (2), C-Term (1), Middle Region (1), N-Term,AA 22-52 (1)