Zinc Finger Protein 79 (ZNF79) antibody

Antigen: Zinc Finger Protein 79 (ZNF79)

Synonyms: pT7

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN183232

Additional Information

Alternative name: ZNF79

Gene ID: ZNF79

UniProt: Q15937

Immunogen: The immunogen for anti-ZNF79 antibody: synthetic peptide directed towards the N terminal of human ZNF79

Sequence: PSPGWKIISGSPPEQALSEASFQDPCVEMPPGDSDHGTSD LEKSFNLRPV

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ZNF79 antibody concentration is 1 mg/ml.

Description: ZNF79 mapped to 9q34 centromeric to the ABL gene and between a constitutional chromosomal translocation on the centromeric side and the CML specific ABL translocation on the telomeric side.

Characteristics: Antigen Size: 498 amino acids

Molecular Weight: 55kDa

Application Details

Application Notes: WB Suggested Anti-ZNF79 Antibody Titration: 0.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF79 Antibody Titration: 0.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

Publications

Product: Williams, Blacklow, Collins: "The zinc finger-associated SCAN box is a conserved oligomerization domain." in: Molecular and cellular biology, Vol. 19, Issue 12, pp. 8526-35, 2000 (PubMed).