Zinc Finger Protein 322A (ZNF322A) antibody

Antigen: Zinc Finger Protein 322A (ZNF322A)

Synonyms: HCG12, ZNF322, ZNF388, ZNF489, FLJ23393, bA457M11.2, bA457M11.3, ZNF322A, MGC157324

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN183270

Additional Information

Alternative name: ZNF322A

Gene ID: ZNF322A

UniProt: Q6U7Q0

Immunogen: The immunogen for anti-ZNF322A antibody: synthetic peptide directed towards the N terminal of human ZNF322A

Sequence: RTHTGEKPYKCDMCEKTFVQSSDLTSHQRIHNYEKPYKCS KCEKSFWHHL

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF322A antibody concentration is 1 mg/ml.

Description: ZNF322 contains four exons and spans 23.2kb in chromosome 6p22.1 region, and transcribes a 2.7kb mRNA that encodes a protein with 402 amino acid residues.Through northern blot analysis, ZNF322 was shown to be expressed in every human tissue examined at adult stage and during embryonic developmental stages from 80 days to 24 weeks. When ZNF322 was overexpressed in COS-7 cells, ZNF322-EGFP fusion protein is detected in the nucleus and cytoplasm. Reporter gene assays show that ZNF322 is a transcriptional activator. Furthermore, overexpression of ZNF322 in COS-7 cells activates the transcriptional activity of SRE and AP-1. Together, these results suggest that ZNF322 is a member of the zinc-finger transcription factor family and may act as a positive regulator in gene transcription mediated by the MAPK signaling pathways.

Characteristics: Antigen Size: 402 amino acids

Molecular Weight: 47kDa

Application Details

Application Notes: WB Suggested Anti-ZNF322A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF322A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

Publications

Product: Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).