Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

ALX Homeobox 4 (ALX4) antibody

Antigen

ALX Homeobox 4 (ALX4)

Synonyms lst, KIAA1788, ALX4, im:7142878
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183394
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ALX4
Gene ID ALX4
UniProt Q9H161
Immunogen The immunogen for anti-ALX4 antibody: synthetic peptide directed towards the N terminal of human ALX4
Sequence SSPFRAFPGGDKFGTTFLSAAAKAQGFGDAKSRARYGAGQ QDLATPLESG
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-ALX4 antibody concentration is 1 mg/ml.
Description ALX4 may be rendered functionally haploinsufficient by a position effect
Characteristics Antigen Size: 411 amino acids
Molecular Weight 44kDa

Application Details

Application Notes WB Suggested Anti-ALX4 Antibody Titration: 0.625ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications

Product Wakui, Gregato, Ballif et al.: "Construction of a natural panel of 11p11.2 deletions and further delineation of the critical region involved in Potocki-Shaffer syndrome." in: European journal of human genetics : EJHG, Vol. 13, Issue 5, pp. 528-40, 2005 (PubMed).

Alternatives

Alternatives for antigen "ALX Homeobox 4 (ALX4)", type "Antibodies"
Hosts Rabbit (14), Mouse (8)
Reactivities Human (17), Mouse (Murine) (9), Dog (Canine) (4), Rat (Rattus) (4), Cow (Bovine) (3), Chicken (1)
Applications Western Blotting (WB) (21), ELISA (3), Flow Cytometry (FACS) (3), Immunofluorescence (IF) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1)
Epitopes N-Term (3), Center (2), Internal Region (2), C-Term (1), Internal Region,AA 256-283 (1)