Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Distal-Less Homeobox 4 (DLX4) antibody

Antigen

Distal-Less Homeobox 4 (DLX4)
Synonyms BP1, DLX7, DLX8, DLX9, Dlx7, Dlx-4, MGC129167, DLX4, MGC149037
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human, Mouse (Murine), Rat (Rattus)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183408
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Distal-Less Homeobox 4 (DLX4) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name DLX4 / BP1
Gene ID DLX4
UniProt P70436
Immunogen The immunogen for anti-DLX4 antibody: synthetic peptide directed towards the N terminal of mouse DLX4
Sequence YSHPGPATPGDSYLPRQQQLVAPSQPFHRPAEHPQELEAE SEKLALSLVP
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-DLX4 antibody concentration is 1 mg/ml.
Description DLX4 is a member of the family of Dlx genes that are involved in early vertebrate morphogenesis, notably of the head.
Characteristics Antigen Size: 240 amino acids
Molecular Weight 26kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-DLX4 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: NIH/3T3 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Kelly, Jerome-Majewska, Papaioannou: "The del22q11.2 candidate gene Tbx1 regulates branchiomeric myogenesis." in: Human molecular genetics, Vol. 13, Issue 22, pp. 2829-40, 2004 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Distal-Less Homeobox 4 (DLX4)", type "Antibodies"
Hosts Rabbit (46), Mouse (4), Sheep (2)
Reactivities Human (49), Mouse (Murine) (31), Rat (Rattus) (24), Cow (Bovine) (23), Dog (Canine) (19), Cat (Feline) (1), Chicken (1)
Applications Western Blotting (WB) (33), Immunofluorescence (IF) (21), ELISA (18), Immunohistochemistry (IHC) (10), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoprecipitation (IP) (3), Immunocytochemistry (ICC) (2), Dot Blot (Dot) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes Internal Region (5), N-Term (5), Center (2), AA 1-60 (1)