Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

ISL LIM Homeobox 2 (ISL2) antibody

Antigen

ISL LIM Homeobox 2 (ISL2)

Synonyms FLJ10160
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Mouse (Murine), Rat (Rattus), Chicken, Human

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183487
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Islet-2 / ISL2
Gene ID ISL2
UniProt Q9CXV0
Immunogen The immunogen for anti-ISL2 antibody: synthetic peptide directed towards the C terminal of mouse ISL2
Sequence VIRVWFQNKRCKDKKKSILMKQLQQQQHSDKASFQGLTGT PLVAGSPIGH
Cross-Reactivity Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-ISL2 antibody concentration is 1 mg/ml.
Description Isl2 specifies RGC laterality by repressing an ipsilateral pathfinding program unique to VTC RGCs and involving Zic2 and EphB1. This genetic hierarchy controls binocular vision.
Characteristics Antigen Size: 359 amino acids
Molecular Weight 39kDa

Application Details

Application Notes WB Suggested Anti-ISL2 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Svärd, Heby-Henricson, Henricson et al.: "Genetic elimination of Suppressor of fused reveals an essential repressor function in the mammalian Hedgehog signaling pathway." in: Developmental cell, Vol. 10, Issue 2, pp. 187-97, 2006 (PubMed).

Alternatives

Alternatives for antigen "ISL LIM Homeobox 2 (ISL2)", type "Antibodies"
Hosts Rabbit (27), Mouse (4)
Reactivities Human (30), Mouse (Murine) (22), Rat (Rattus) (21), Chicken (19), Cow (Bovine) (2), Zebrafish (2), Xenopus laevis (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (14), ELISA (8), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Dot Blot (Dot) (1), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes N-Term (2), C-Term (1), Internal Region (1)