Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Reproductive Homeobox 11 (Rhox11) antibody

Antigen

Reproductive Homeobox 11 (Rhox11)

Synonyms Gm39, BC049711, MGC58663
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Mouse (Murine)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183531
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name RHOX11
Gene ID RHOX11
UniProt Q810N8
Immunogen The immunogen for anti-RHOX11 antibody: synthetic peptide directed towards the N terminal of mouse RHOX11
Sequence VMPNTQDTGREEPEETSKVAETSEQSLFRIPRKAYRFTPG QLWELQAVFV
Cross-Reactivity Mouse (Murine)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-RHOX11 antibody concentration is 1 mg/ml.
Description Homeobox proteins are transcription factors notable for their ability to regulate embryogenesis. The reproductive homeobox proteins (Rhox) are expressed in a cell type-specific manner, several are hormonally regulated, and their expression pattern during postnatal testis development corresponds to their chromosomal position. Most of the Rhox proteins are expressed in Sertoli cells, the nurse cells in direct contact with developing male germ cells, suggesting that they regulate the expression of somatic-cell gene products critical for germ cell development.
Characteristics Antigen Size: 206 amino acids
Molecular Weight 23kDa

Application Details

Application Notes WB Suggested Anti-RHOX11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Maclean, Chen, Wayne et al.: "Rhox: a new homeobox gene cluster." in: Cell, Vol. 120, Issue 3, pp. 369-82, 2005 (PubMed).

Alternatives

Alternatives for antigen "Reproductive Homeobox 11 (Rhox11)", type "Antibodies"
Hosts Rabbit (4)
Reactivities Mouse (Murine) (4)
Applications Western Blotting (WB) (4), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2)
Epitopes AA 139-152 (1), N-Term (1)