Zinc Finger Protein 12 (ZNF12) antibody

Antigen: Zinc Finger Protein 12 (ZNF12)

Synonyms: KOX3, HZF11, GIOT-3, ZNF325

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN183567

Additional Information

Alternative name: ZNF12

Gene ID: ZNF12

Immunogen: The immunogen for anti-ZNF12 antibody: synthetic peptide directed towards the N terminal of human ZNF12

Sequence: ADECSGCGKSLLHIKLEKTHPGDQAYEFNQNGEPYTLNEE SLYQKIRILE

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ZNF12 antibody concentration is 1 mg/ml.

Description: Two members of the human zinc finger Kruppel family, ZNF 12 (KOX 3) and ZNF 26 (KOX 20), have been localized by somatic cell hybrid analysis and in situ chromosomal hybridization. The presence of individual human zinc finger genes in mouse-human hybrid DNAs was correlated with the presence of specific human chromosomes or regions of chromosomes in the corresponding cell hybrids. Analysis of such mouse-human hybrid DNAs assigned the ZNF 12 (KOX 3) gene to chromosome region 7p.

Characteristics: Antigen Size: 697 amino acids

Molecular Weight: 77kDa

Application Details

Application Notes: WB Suggested Anti-ZNF12 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF12 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

Publications

Product: Abrink, Aveskogh, Hellman: "Isolation of cDNA clones for 42 different Krüppel-related zinc finger proteins expressed in the human monoblast cell line U-937." in: DNA and cell biology, Vol. 14, Issue 2, pp. 125-36, 1995 (PubMed).