Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

DPF2 antibody

Antigen

DPF2
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Chicken, Zebrafish
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183707
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-DPF2 antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name UBID4 / DPF2
Gene ID DPF2
UniProt Q92785
Immunogen The immunogen for anti-DPF2 antibody: synthetic peptide directed towards the N terminal of human DPF2
Sequence MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLP FLDSQTGVAQ
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-DPF2 antibody concentration is 1 mg/ml.
Description DPF2 is a member of the d4 domain family, characterized by a zinc finger-like structural motif. DPF2 functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory
Characteristics Antigen Size: 391 amino acids
Molecular Weight 44kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-DPF2 Antibody Titration: 0.3125ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "DPF2", type "Antibodies"
Hosts Rabbit (40), Mouse (7)
Reactivities Human (47), Mouse (Murine) (26), Rat (Rattus) (25), Chicken (21), Cow (Bovine) (21), Dog (Canine) (21), Xenopus laevis (3), Zebrafish (2), Cat (Feline) (1), Hamster (1)
Applications Western Blotting (WB) (31), ELISA (22), Immunofluorescence (IF) (19), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (7), Immunohistochemistry (IHC) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunoprecipitation (IP) (2), Dot Blot (Dot) (1), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes Internal Region (5), N-Term (4), C-Term (3), Center (1)