CCR4-NOT Transcription Complex, Subunit 7 (CNOT7) antibody

Antigen: CCR4-NOT Transcription Complex, Subunit 7 (CNOT7)

Synonyms: CAF1, hCAF-1, CNOT7, MGC128204, fd59c07, fj07d05, wu:fd59c07, wu:fj07d05, zgc:153168

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Chicken, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN183752

Additional Information

Alternative name: CNOT7

Gene ID: CNOT7

Immunogen: The immunogen for anti-CNOT7 antibody: synthetic peptide directed towards the N terminal of human CNOT7

Sequence: TEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLT FMNEQGEYPP

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CNOT7 antibody concentration is 1 mg/ml.

Description: CNOT7 binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The protein has both mouse and yeast orthologs.The protein encoded by this gene binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The protein has both mouse and yeast orthologs. Alternate splicing of this gene results in two transcript variants encoding different isoforms.

Characteristics: Antigen Size: 262 amino acids

Molecular Weight: 30kDa

Application Details

Application Notes: WB Suggested Anti-CNOT7 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-CNOT7 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).