Pogo Transposable Element with ZNF Domain (POGZ) antibody

Antigen: Pogo Transposable Element with ZNF Domain (POGZ)

Synonyms: SUHW5, ZNF635, ZNF280E, ZNF635m, KIAA0461, MGC71543, AU015913, AU044539, 9530006B08Rik, POGZ

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Rabbit

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN183768

Additional Information

Alternative name: POGZ

Gene ID: POGZ

UniProt: Q7Z3K3

Immunogen: The immunogen for anti-POGZ antibody: synthetic peptide directed towards the N terminal of human POGZ

Sequence: EELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVSAP VPIAAHASVA

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-POGZ antibody concentration is 1 mg/ml.

Description: POGZ appears to be a zinc finger protein containing a transposase domain at the C-terminus. This protein was found to interact with the transcription factor SP1 in a yeast two-hybrid systemThe protein encoded by this gene appears to be a zinc finger protein containing a transposase domain at the C-terminus. This protein was found to interact with the transcription factor SP1 in a yeast two-hybrid system. At least three alternatively spliced transcript variants encoding distinct isoforms have been observed.

Characteristics: Antigen Size: 1410 amino acids

Molecular Weight: 155kDa

Application Details

Application Notes: WB Suggested Anti-POGZ Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-POGZ Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain

anti-Pogo Transposable Element with ZNF Domain (POGZ) antibody (Image 2)

anti-Pogo Transposable Element with ZNF Domain (POGZ) antibody (Image 3)

Publications

Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).