Zinc Finger Protein 253 (ZNF253) antibody

Antigen: Zinc Finger Protein 253 (ZNF253)

Synonyms: BMZF1, BMZF-1, ZNF411, FLJ90391, ZNF253

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human

Application: Western Blotting (WB)

Catalog no.: ABIN183802

Additional Information

Alternative name: ZNF253

Gene ID: ZNF253

UniProt: O75346

Immunogen: The immunogen for anti-ZNF253 antibody: synthetic peptide directed towards the C terminal of human ZNF253

Sequence: LTTHKRIHTGEKPYKCEECGKAFNWSSDLNKHKKIHIERK PYIVKNVTDL

Cross-Reactivity: Cow (Bovine), Human

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ZNF253 antibody concentration is 1 mg/ml.

Description: ZNF253 may function as a transcription factor. Seem to have a transcriptional repression activity

Characteristics: Antigen Size: 275 amino acids

Molecular Weight: 32kDa

Application Details

Application Notes: WB Suggested Anti-ZNF253 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF253 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Publications

Product: Han, Zhang, Ye et al.: "Molecular cloning of six novel Krüppel-like zinc finger genes from hematopoietic cells and identification of a novel transregulatory domain KRNB." in: The Journal of biological chemistry, Vol. 274, Issue 50, pp. 35741-8, 2000 (PubMed).