Zinc Finger Protein 496 (ZNF496) antibody

Antigen: Zinc Finger Protein 496 (ZNF496)

Synonyms: Zfp496, Zkscan17, ZNF496

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN183828

Additional Information

Alternative name: ZNF496

Gene ID: ZNF496

UniProt: Q96IT1

Immunogen: The immunogen for anti-ZNF496 antibody: synthetic peptide directed towards the N terminal of human ZNF496

Sequence: MPTALCPRVLAPKESEEPRKMRSPPGENPSPQGELPSPES SRRLFRRFRY

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ZNF496 antibody concentration is 1 mg/ml.

Description: ZNF496 contains a SCAN box, a KRAB-A domain, and four consensus C2H2-type zinc fingers preceded by a unique finger derivative, referred to herein as the C2HR motif. The C2HR motif functions to mediate protein-protein interaction with the cysteine-rich (C5HCH) domain of NSD1 in a Zn(II)-dependent fashion, and when tethered to RNA polymerase II promoters, represses transcription in an NSD1-dependent manner. ZNF496 contains a novel type of zinc finger motif that functions as a docking site for NSD1 and is more than just a degenerate evolutionary remnant of a C2H2 motif.

Characteristics: Antigen Size: 587 amino acids

Molecular Weight: 67kDa

Application Details

Application Notes: WB Suggested Anti-ZNF496 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF496 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate

Publications

Product: Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).