Methyl-CpG Binding Domain Protein 2 (MBD2) antibody

Antigen: Methyl-CpG Binding Domain Protein 2 (MBD2)

Synonyms: DMTase, NY-CO-41, DKFZp586O0821, MBD2a, MGC111862, wu:fa97f06, zgc:111862, MBD2, MGC188552

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Xenopus laevis, Zebrafish, Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN183889

Additional Information

Alternative name: MBD2

Gene ID: MBD2

UniProt: Q9UBB5-3

Immunogen: The immunogen for anti-MBD2 antibody: synthetic peptide directed towards the middle region of human MBD2

Sequence: DCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSK PQLARYLGNT

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-MBD2 antibody concentration is 1 mg/ml.

Description: MBD2 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD2 can also repress transcription from methylated gene promoters. MBD2 may function as a mediator of the biological consequences of the methylation signal.It is also reported that the MBD2 functions as a demethylase to activate transcription, as DNA methylation causes gene silencing.DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. The protein encoded by this gene may function as a mediator of the biological consequences of the methylation signal. It is also reported that the this protein functions as a demethylase to activate transcription, as DNA methylation causes gene silencing.

Characteristics: Antigen Size: 302 amino acids

Molecular Weight: 32kDa

Application Details

Application Notes: WB Suggested Anti-MBD2 Antibody Titration: 0.625ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Chromatin Binding Proteins

Restrictions: For Research Use only

Images

WB Suggested Anti-MBD2 Antibody Titration: 0.625ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate

Publications

Product: Le Guezennec, Vermeulen, Brinkman et al.: "MBD2/NuRD and MBD3/NuRD, two distinct complexes with different biochemical and functional properties." in: Molecular and cellular biology, Vol. 26, Issue 3, pp. 843-51, 2006 (PubMed).