Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member A (ANP32A) antibody

Antigen

Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member A (ANP32A)

Synonyms
LANP, MAPM, PP32, PHAP1, PHAPI, I1PP2A, C15orf1, MGC119787, MGC150373, pp32, Anp32, W91701, MGC105504, anon-EST:fe3A2, Anp32a, CG5784, CT18148, CT42180, DmelCG5784, zgc:55516, wu:fj36e08, ANP32A, HPPC ... show more
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Chicken, Zebrafish

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN183894
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ANP32A
Gene ID ANP32A
UniProt P39687
Immunogen The immunogen for anti-ANP32A antibody: synthetic peptide directed towards the middle region of human ANP32A
Sequence FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDA EGYVEGLDDE
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ANP32A antibody concentration is 1 mg/ml.
Description ANP32A is a novel potent heat-stable inhibitor protein of protein phosphatase 2A. It may play a key role in self-renewing cell populations where it may act in the nucleus to limit their sensitivity to transformation. Being a tumor suppressor, ANP32A represses cell growth through inhibition of transcription by blocking acetylation and phosphorylation of histone H3 and initiating its proapoptotic activity.
Characteristics Antigen Size: 249 amino acids
Molecular Weight 29kDa
Synonyms LANP, MAPM, PP32, PHAP1, PHAPI, I1PP2A, C15orf1, MGC119787, MGC150373, pp32, Anp32, W91701, MGC105504, anon-EST:fe3A2, Anp32a, CG5784, CT18148, CT42180, DmelCG5784, zgc:55516, wu:fj36e08, ANP32A, HPPCn, ANP32D

Application Details

Application Notes WB Suggested Anti-ANP32A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Alternatives

Alternatives for antigen "Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member A (ANP32A)", type "Antibodies"
Hosts Rabbit (50), Mouse (9)
Reactivities Human (57), Mouse (Murine) (31), Rat (Rattus) (29), Cow (Bovine) (21), Dog (Canine) (20), Horse (Equine) (18), Pig (Porcine) (18), Chicken (2), Cat (Feline) (1), Chimpanzee (1), Rhesus Monkey (1), Xenopus laevis (1), Zebrafish (1)
Applications Western Blotting (WB) (44), ELISA (27), Immunofluorescence (IF) (24), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (17), Immunohistochemistry (IHC) (13), Immunocytochemistry (ICC) (5), Immunoprecipitation (IP) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1)
Conjugates Biotin (2), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (8), N-Term (3), AA 87-103 (1), Center (1), Internal Region (1)