Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member A (ANP32A) antibody
| Antigen | Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member A (ANP32A) |
| Synonyms |
LANP, MAPM, PP32, PHAP1, PHAPI, I1PP2A, C15orf1, MGC119787, MGC150373, pp32, Anp32, W91701, MGC105504, anon-EST:fe3A2, Anp32a, CG5784, CT18148, CT42180, DmelCG5784, zgc:55516, wu:fj36e08, ANP32A, HPPC ...
show more
|
| Clonality | Polyclonal |
| Host |
Alternatives Rabbit |
| Reactivity |
Alternatives Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Chicken, Zebrafish |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB), Immunohistochemistry (IHC) |
![]() |
1 reference available |
| Catalog no. | ABIN183894 |
| Quantity | 50 µg (Variants) |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | ANP32A |
| Gene ID | ANP32A |
| UniProt | P39687 |
| Immunogen | The immunogen for anti-ANP32A antibody: synthetic peptide directed towards the middle region of human ANP32A |
| Sequence | FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDA EGYVEGLDDE |
| Cross-Reactivity | Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-ANP32A antibody concentration is 1 mg/ml. |
| Description | ANP32A is a novel potent heat-stable inhibitor protein of protein phosphatase 2A. It may play a key role in self-renewing cell populations where it may act in the nucleus to limit their sensitivity to transformation. Being a tumor suppressor, ANP32A represses cell growth through inhibition of transcription by blocking acetylation and phosphorylation of histone H3 and initiating its proapoptotic activity. |
| Characteristics | Antigen Size: 249 amino acids |
| Molecular Weight | 29kDa |
| Synonyms | LANP, MAPM, PP32, PHAP1, PHAPI, I1PP2A, C15orf1, MGC119787, MGC150373, pp32, Anp32, W91701, MGC105504, anon-EST:fe3A2, Anp32a, CG5784, CT18148, CT42180, DmelCG5784, zgc:55516, wu:fj36e08, ANP32A, HPPCn, ANP32D |
Application Details
| Application Notes |
WB Suggested Anti-ANP32A Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate. |
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Restrictions | For Research Use only |
Images
Publications
| Product |
Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).
|
Alternatives
Alternatives for antigen "Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member A (ANP32A)", type "Antibodies"
| Hosts | Rabbit (50), Mouse (9) |
| Reactivities | Human (57), Mouse (Murine) (31), Rat (Rattus) (29), Cow (Bovine) (21), Dog (Canine) (20), Horse (Equine) (18), Pig (Porcine) (18), Chicken (2), Cat (Feline) (1), Chimpanzee (1), Rhesus Monkey (1), Xenopus laevis (1), Zebrafish (1) |
| Applications | Western Blotting (WB) (44), ELISA (27), Immunofluorescence (IF) (24), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (17), Immunohistochemistry (IHC) (13), Immunocytochemistry (ICC) (5), Immunoprecipitation (IP) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1) |
| Conjugates | Biotin (2), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1) |
| Epitopes | C-Term (8), N-Term (3), AA 87-103 (1), Center (1), Internal Region (1) |




Alternatives