Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183915

Obg-Like ATPase 1 (OLA1) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
DOC45, GBP45, GTBP9, GTPBP9, PTD004, RGD1307982, 2510025G09Rik, 2810405J23Rik, 2810409H07Rik, Gtpbp9, fe36h01, zgc:55768, zgc:85691, wu:fc66b09, wu:fe36h01, wu:fk82a02, MGC54033, MGC79585, DKFZp469M10 ... show more
Reactivity
»Alternatives Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Fruit Fly (Drosophila melanogaster), Zebrafish, Chicken, Xenopus laevis
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183915
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GTPBP9 antibody: synthetic peptide directed towards the C terminal of human GTPBP9
Sequence QAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKY RQQGRNYIVE
Cross-Reactivity Cow (Bovine), Chicken, Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)
Predicted Reactivity Rat :100%,   Bovine :100%,   Mouse :100%,   Green puffer :100%,   Sumatran orangutan :100%,   Chicken :100%,   Western clawed frog :100%,   African malaria mosquito :100%,   Zebrafish :100%,   African clawed frog :100%,   Human :100%,   Silk moth :100%,   Harpegnathos saltator :100%,   White-tufted-ear marmoset :100%,   Filarial nematode worm :100%,   Southern house mosquito :100%,   Fruit fly :100%,   Trichoplax reptans :100%,   salmon louse :100%,   Pea aphid :100%,   Savannah tsetse fly :100%,   Red flour beetle :100%,   Eye worm :100%,   Yellowfever mosquito :92%,   Camponotus floridanus :92%,   Florida lancelet :92%,   Black-legged tick :92%,   Atlantic salmon :92%,   Chlamydomonas smithii :85%,   Volvox carteri f. nagariensis :85%,   Rainbow smelt :85%,   Choanoflagellate :85%,   Mouse-ear cress :78%,   Ostreococcus tauri :78%,   Spikemoss :78%,   Arabidopsis lyrata subsp. lyrata :78%,   Blood fluke :78%,   Smut fungus :78%,   Entamoeba histolytica :78%,   Rice :78%,  
Characteristics Antigen Size: 396 amino acids
Purification Affinity Purified
Alternative Name GTPBP9 / OLA1
Background GTPBP9 belongs to the GTP1/OBG family and the function remains unknown.
Molecular Weight 44kDa
Gene ID GTPBP9
UniProt Q9NTK5
Application Notes WB Suggested Anti-GTPBP9 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µl of distilled water
Buffer Final anti-GTPBP9 antibody concentration is 1 mg/ml.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Background publications Wiemann, Weil, Wellenreuther et al.: "Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." in: Genome research, Vol. 11, Issue 3, pp. 422-35, 2001 (PubMed).

Alternatives for antigen "Obg-Like ATPase 1 (OLA1)", type "Antibodies"
Hosts (32)
Reactivities (28), (18), (18), (15), (15), (2), (1), (1), (1)
Applications (23), (10), (8), (7), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (10), (2), (2), (1)
Beacon