Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184033

Exosome Component 7 (EXOSC7) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EAP1, RRP42, Rrp42p, hRrp42p, p8, AV212732, mKIAA0116, 2610002K22Rik, zgc:110717, EXOSC7
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN184033
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EXOSC7 antibody: synthetic peptide directed towards the N terminal of human EXOSC7
Sequence LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLY RIFNNKSSVD
Predicted Reactivity Dog : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Pig : 92%, African clawed frog : 85%, Chicken : 85%, Zebrafish : 78%
Characteristics This is a rabbit polyclonal antibody against EXOSC7. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name EXOSC7
Background EXOSC7 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.
Molecular Weight 32kDa
Gene ID 23016
NCBI Accession NP_055819, NM_015004
UniProt Q15024
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EXOSC7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Raijmakers, Egberts, van Venrooij et al.: "Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring." in: Journal of molecular biology, Vol. 323, Issue 4, pp. 653-63, 2002 (PubMed).

Alternatives for antigen "Exosome Component 7 (EXOSC7)", type "Antibodies"
Hosts (17), (17)
Reactivities (32), (15), (15), (14), (13), (13), (12), (1), (1)
Applications (23), (10), (10), (5), (5), (5), (4), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (1)
Beacon