Exosome Component 7 (EXOSC7) (N-Term) antibody

Details for Product No. ABIN184033
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms EAP1, RRP42, Rrp42p, hRrp42p, p8, AV212732, mKIAA0116, 2610002K22Rik, zgc:110717, EXOSC7
Epitope
N-Term
(3), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human, Chicken
(32), (14), (14), (14), (13), (13), (12), (1), (1)
Host
Rabbit
(17), (17)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(23), (10), (10), (5), (5), (5), (4), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN184033
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human EXOSC7
Sequence LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLY RIFNNKSSVD
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Pig : 90 %, African clawed frog : 80 %, Chicken : 80 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against EXOSC7. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name EXOSC7
Background EXOSC7 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.
Molecular Weight 32 kDa
Gene ID 23016
NCBI Accession NM_015004, NP_055819
UniProt Q15024
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 291 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Exosome Component 7 (EXOSC7) (N-Term) antibody WB Suggested Anti-EXOSC7 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
anti-Exosome Component 7 (EXOSC7) (N-Term) antibody (2) anti-Exosome Component 7 (EXOSC7) (N-Term) antibody (Image 2)
Background publications Raijmakers, Egberts, van Venrooij et al.: "Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring." in: Journal of molecular biology, Vol. 323, Issue 4, pp. 653-63, 2002 (PubMed).

Hosts (17), (17)
Reactivities (32), (14), (14), (14), (13), (13), (12), (1), (1)
Applications (23), (10), (10), (5), (5), (5), (4), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (1)
back to top