Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Interferon Regulatory Factor 8 (IRF8) antibody

Antigen

Interferon Regulatory Factor 8 (IRF8)

Synonyms ICSBP, IRF-8, ICSBP1, H-ICSBP, Myls, Icsbp1, AI893568, IRF8, zgc:92252, icsbp1, MGC80112, MGC140338, DKFZp469B0320
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Chicken, Xenopus laevis

Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN184318
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name IRF8 / ICSBP1
Gene ID IRF8
UniProt Q02556
Immunogen The immunogen for anti-IRF8 antibody: synthetic peptide directed towards the N terminal of human IRF8
Sequence MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAE PATWKTRLRC
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-IRF8 antibody concentration is 1 mg/ml.
Description Interferon regulatory factor 8 (IRF8, interferon consensus sequence-binding protein, Ion ChannelSBP) is a transcription factor of the interferon (IFN) regulatory factor (IRF) family. Proteins of this family are composed of a conserved DNA-binding domain in the N-terminal region and a divergent C-terminal region that serves as the regulatory domain. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-. and IFN-.. IRF family proteins also control expression of IFN-. and IFN-.-regulated genes that are induced by viral infection.
Characteristics Antigen Size: 426 amino acids
Molecular Weight 48kDa

Application Details

Application Notes WB Suggested Anti-IRF8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Weisz, Marx, Sharf et al.: "Human interferon consensus sequence binding protein is a negative regulator of enhancer elements common to interferon-inducible genes." in: The Journal of biological chemistry, Vol. 267, Issue 35, pp. 25589-96, 1993 (PubMed).

Alternatives

Alternatives for antigen "Interferon Regulatory Factor 8 (IRF8)", type "Antibodies"
Hosts Rabbit (30), Goat (5)
Reactivities Human (31), Mouse (Murine) (13), Rat (Rattus) (9), Cow (Bovine) (3), Dog (Canine) (3), Chicken (2), Cat (Feline) (1), Xenopus laevis (1), Zebrafish (1)
Applications Western Blotting (WB) (33), ELISA (19), Immunohistochemistry (IHC) (9), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (6), Dot Blot (DB) (1), Immunofluorescence (IF) (1), Immunoprecipitation (IP) (1)
Epitopes C-Term (12), Internal Region (2), N-Term (2), Center (1)