Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184318

Interferon Regulatory Factor 8 (IRF8) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ICSBP, IRF-8, ICSBP1, H-ICSBP, Myls, Icsbp1, AI893568, icsbp1, zgc:92252, IRF8, MGC140338, DKFZp469B0320
Reactivity
»Alternatives Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Chicken, Xenopus laevis
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN184318
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-IRF8 antibody: synthetic peptide directed towards the N terminal of human IRF8
Sequence MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAE PATWKTRLRC
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%
Characteristics Antigen Size: 426 amino acids
Purification Affinity Purified
Alternative Name IRF8 / ICSBP1
Background Interferon regulatory factor 8 (IRF8, interferon consensus sequence-binding protein, Ion ChannelSBP) is a transcription factor of the interferon (IFN) regulatory factor (IRF) family. Proteins of this family are composed of a conserved DNA-binding domain in the N-terminal region and a divergent C-terminal region that serves as the regulatory domain. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-. and IFN-.. IRF family proteins also control expression of IFN-. and IFN-.-regulated genes that are induced by viral infection.
Molecular Weight 48kDa
Gene ID IRF8
UniProt Q02556
Application Notes WB Suggested Anti-IRF8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µl of distilled water
Buffer Final anti-IRF8 antibody concentration is 1 mg/ml.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Background publications Weisz, Marx, Sharf et al.: "Human interferon consensus sequence binding protein is a negative regulator of enhancer elements common to interferon-inducible genes." in: The Journal of biological chemistry, Vol. 267, Issue 35, pp. 25589-96, 1993 (PubMed).

Alternatives for antigen "Interferon Regulatory Factor 8 (IRF8)", type "Antibodies"
Hosts (42), (9), (1)
Reactivities (48), (23), (18), (4), (2), (2), (1), (1), (1)
Applications (50), (21), (9), (7), (6), (2), (1)
Epitopes (23), (2), (2), (2), (2), (1), (1), (1)
Beacon