Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184328

Transcription Factor 7 (T-Cell Specific, HMG-Box) (TCF7) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Tcf1, TCF-1, AI465550
Reactivity
»Alternatives Dog (Canine), Human, Mouse (Murine)
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN184328
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the C terminal of human TCF7
Sequence YLPGEGRCPSPVPSDDSALGCPGSPAPQDSPSYHLLPRFP TELLTSPAER
Cross-Reactivity Dog (Canine), Human, Mouse (Murine)
Predicted Reactivity Human : 100%, Dog : 93%, Mouse : 86%, Rat : 86%
Characteristics Antigen Size: 494 amino acids
Purification Affinity Purified
Alternative Name TCF7 / TCF1
Background The T-cell-specific transcription factor TCF7 activates genes involved in immune regulation and is a candidate locus for genetic susceptibility to type 1 diabetes.
Molecular Weight 54kDa
Gene ID TCF7
UniProt P36402-3
Application Notes WB Suggested Anti-TCF7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µl of distilled water
Buffer Final anti-TCF7 antibody concentration is 1 mg/ml.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Background publications Roose, Huls, van Beest et al.: "Synergy between tumor suppressor APC and the beta-catenin-Tcf4 target Tcf1." in: Science (New York, N.Y.), Vol. 285, Issue 5435, pp. 1923-6, 1999 (PubMed).

Alternatives for antigen "Transcription Factor 7 (T-Cell Specific, HMG-Box) (TCF7)", type "Antibodies"
Hosts (24), (8), (2)
Reactivities (34), (10), (2), (2), (2)
Applications (32), (16), (5), (4), (3), (2), (2), (1), (1), (1)
Epitopes (7), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon