Transcription Factor 7 (T-Cell Specific, HMG-Box) (TCF7) antibody

Antigen: Transcription Factor 7 (T-Cell Specific, HMG-Box) (TCF7)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN184328

Additional Information

Alternative name: TCF7 / TCF1

Gene ID: TCF7

UniProt: P36402-3

Immunogen: The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the C terminal of human TCF7

Sequence: YLPGEGRCPSPVPSDDSALGCPGSPAPQDSPSYHLLPRFP TELLTSPAER

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TCF7 antibody concentration is 1 mg/ml.

Description: The T-cell-specific transcription factor TCF7 activates genes involved in immune regulation and is a candidate locus for genetic susceptibility to type 1 diabetes.

Characteristics: Antigen Size: 494 amino acids

Molecular Weight: 54kDa

Application Details

Application Notes: WB Suggested Anti-TCF7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TCF7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Roose, Huls, van Beest et al.: "Synergy between tumor suppressor APC and the beta-catenin-Tcf4 target Tcf1." in: Science (New York, N.Y.), Vol. 285, Issue 5435, pp. 1923-6, 1999 (PubMed).