Cold Shock Domain Protein A (CSDA) antibody

Antigen: Cold Shock Domain Protein A (CSDA)

Synonyms: DBPA, CSDA1, ZONAB, csda-A, p54, CSDA, MGC148333, MGC115344

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN184338

Additional Information

Alternative name: DNA-binding protein A

Gene ID: CSDA

UniProt: P16989

Immunogen: The immunogen for anti-CSDA antibody: synthetic peptide directed towards the C terminal of human CSDA

Sequence: GPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYN YRRRPRPPNA

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-CSDA antibody concentration is 1 mg/ml.

Description: Human DNA-binding protein (dbpA) is a member of a Y-box binding protein family containing a cold shock domain. The increased expression of Y box binding proteins in somatic cells is associated with cell proliferation and transformation.

Characteristics: Antigen Size: 372 amino acids

Molecular Weight: 40kDa

Application Details

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Publications

Chiu, Witkowska, Hall et al.: "High-molecular-mass APOBEC3G complexes restrict Alu retrotransposition." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 42, pp. 15588-93, 2006 (PubMed).

Product: Hayashi, Kajino, Umeda et al.: "Somatic mutation and SNP in the promoter of dbpA and human hepatocarcinogenesis." in: International journal of oncology, Vol. 21, Issue 4, pp. 847-50, 2002 (PubMed).