Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Cold Shock Domain Protein A (CSDA) antibody

Antigen

Cold Shock Domain Protein A (CSDA)

Synonyms DBPA, CSDA1, ZONAB, csda-A, p54, CSDA, MGC148333, MGC115344
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application
Alternatives Western Blotting (WB)
2 references available
Catalog no. ABIN184338
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name DNA-binding protein A
Gene ID CSDA
UniProt P16989
Immunogen The immunogen for anti-CSDA antibody: synthetic peptide directed towards the C terminal of human CSDA
Sequence GPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYN YRRRPRPPNA
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-CSDA antibody concentration is 1 mg/ml.
Description Human DNA-binding protein (dbpA) is a member of a Y-box binding protein family containing a cold shock domain. The increased expression of Y box binding proteins in somatic cells is associated with cell proliferation and transformation.
Characteristics Antigen Size: 372 amino acids
Molecular Weight 40kDa

Application Details

Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Chiu, Witkowska, Hall et al.: "High-molecular-mass APOBEC3G complexes restrict Alu retrotransposition." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 42, pp. 15588-93, 2006 (PubMed).

Product Hayashi, Kajino, Umeda et al.: "Somatic mutation and SNP in the promoter of dbpA and human hepatocarcinogenesis." in: International journal of oncology, Vol. 21, Issue 4, pp. 847-50, 2002 (PubMed).

Alternatives

Alternatives for antigen "Cold Shock Domain Protein A (CSDA)", type "Antibodies"
Hosts Rabbit (12), Mouse (3)
Reactivities Human (14), Mouse (Murine) (2), Borrelia burgdorferi (B. burgdorferi) (1), Cow (Bovine) (1), Dog (Canine) (1), Rat (Rattus) (1)
Applications Western Blotting (WB) (15), ELISA (10), Immunofluorescence (IF) (1), Immunohistochemistry (IHC) (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1)
Epitopes C-Term (2), Center (1), N-Term (1)