PBX3 antibody

Antigen: PBX3

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Zebrafish

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN309637

Additional Information

Gene ID: PBX3

UniProt: P40426

Immunogen: The immunogen for anti-PBX3 antibody: synthetic peptide directed towards the N terminal of human PBX3

Sequence: SRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQ DIGDILHQIM

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-PBX3 antibody concentration is 1 mg/ml.

Description: PBX3 is a transcriptional activator that binds the sequence 5'-ATCAATCAA-3'.

Characteristics: Antigen Size: 434 amino acids

Molecular Weight: 47kDa

Application Details

Application Notes: WB Suggested Anti-PBX3 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-PBX3 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate

anti-PBX3 antibody (Image 2)

Publications

Product: Monica, Galili, Nourse et al.: "PBX2 and PBX3, new homeobox genes with extensive homology to the human proto-oncogene PBX1." in: Molecular and cellular biology, Vol. 11, Issue 12, pp. 6149-57, 1991 (PubMed).