Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Ring Finger Protein 138 (RNF138) antibody

Antigen

Ring Finger Protein 138 (RNF138)

Synonyms NARF, HSD-4, STRIN, MGC8758
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN309683
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name RNF138
Gene ID RNF138
UniProt Q8WVD3
Immunogen The immunogen for anti-RNF138 antibody: synthetic peptide directed towards the C terminal of human RNF138
Sequence LFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRHQFDYG EFVNLQLDEE
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-RNF138 antibody concentration is 1 mg/ml.
Description RNF138 contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-DNA and protein-protein interactions.The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-DNA and protein-protein interactions. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Characteristics Antigen Size: 245 amino acids
Molecular Weight 28kDa

Application Details

Application Notes WB Suggested Anti-RNF138 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Cell Cycle, Proteolysis / Ubiquitin, Transcription Factors
Restrictions For Research Use only

Publications

Product Yamada, Ohnishi, Ohkawara et al.: "NARF, an nemo-like kinase (NLK)-associated ring finger protein regulates the ubiquitylation and degradation of T cell factor/lymphoid enhancer factor (TCF/LEF)." in: The Journal of biological chemistry, Vol. 281, Issue 30, pp. 20749-60, 2006 (PubMed).

Alternatives

Alternatives for antigen "Ring Finger Protein 138 (RNF138)", type "Antibodies"
Hosts Rabbit (25)
Reactivities Human (22), Mouse (Murine) (20), Rat (Rattus) (20), Cow (Bovine) (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (7), ELISA (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Biotin (2), FITC (2), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes C-Term (1), Internal Region (1)