Pirin (PIR) antibody

Antigen: Pirin (PIR)

Synonyms: ATPIRIN1, PIRIN, PRN, PRN1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN309704

Additional Information

Alternative name: Pirin / PIR

Gene ID: PIR

UniProt: O00625

Immunogen: The immunogen for anti-PIR antibody: synthetic peptide directed towards the C terminal of human PIR

Sequence: EPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQ HGPFVMNTNE

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-PIR antibody concentration is 1 mg/ml.

Description: PIR is a member of the cupin superfamily. The protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box transcription factor as well as B cell lymphoma 3-encoded oncoprotein suggest the protein may act as a transcriptional cofactor and be involved in the regulation of DNA transcription and replication.This gene encodes a member of the cupin superfamily. The encoded protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box transcription factor as well as B cell lymphoma 3-encoded oncoprotein suggest the encoded protein may act as a transcriptional cofactor and be involved in the regulation of DNA transcription and replication. Alternatively spliced transcript variants have been described.

Characteristics: Antigen Size: 290 amino acids

Molecular Weight: 32kDa

Application Details

Application Notes: WB Suggested Anti-PIR Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-PIR Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Adams, Jia: "Structural and biochemical analysis reveal pirins to possess quercetinase activity." in: The Journal of biological chemistry, Vol. 280, Issue 31, pp. 28675-82, 2005 (PubMed).