Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Ceramide Synthase 4 (CERS4) antibody

Antigen

Ceramide Synthase 4 (CERS4)
Synonyms Trh1, 2900019C14Rik, CerS4, FLJ12089, LASS4, MGC143234
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Rat (Rattus), Mouse (Murine), Pig (Porcine), Dog (Canine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN309804
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Ceramide Synthase 4 (CERS4) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name LASS4
Gene ID LASS4
UniProt Q9HA82
Immunogen The immunogen for anti-LASS4 antibody: synthetic peptide directed towards the C terminal of human LASS4
Sequence MLYSFMKKGQMEKDIRSDVEESDSSEEAAAAQEPLQLKNG AAGGPRPAPT
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-LASS4 antibody concentration is 1 mg/ml.
Description LASS4 is a member of LASS family. Members of this family regulate (dihydro)ceramide synthases responsible for production of sphingolipids containing different fatty acids.
Characteristics Antigen Size: 394 amino acids
Molecular Weight 46kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-LASS4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cancer, Metabolism
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Ceramide Synthase 4 (CERS4)", type "Antibodies"
Hosts Rabbit (30), Mouse (2)
Reactivities Human (31), Mouse (Murine) (20), Rat (Rattus) (20), Dog (Canine) (19), Pig (Porcine) (19), Chicken (18), Cow (Bovine) (18), Horse (Equine) (18)
Applications Western Blotting (WB) (17), Immunofluorescence (IF) (16), ELISA (8), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (2), C-Term (1), Internal Region (1)