Tripartite Motif Containing 32 (TRIM32) antibody

Antigen: Tripartite Motif Containing 32 (TRIM32)

Synonyms: HT2A, BBS11, TATIP, LGMD2H, 3f3, Zfp117, 1810045E12Rik, MGC109467, TRIM32

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN309924

Additional Information

Alternative name: TRIM32 / HT2A

Gene ID: TRIM32

UniProt: Q13049

Immunogen: The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the C terminal of human TRIM32

Sequence: GQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKE ILHFPKGGGY

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-TRIM32 antibody concentration is 1 mg/ml.

Description: TRIM32 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM32 localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.

Characteristics: Antigen Size: 653 amino acids

Molecular Weight: 72kDa

Application Details

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

anti-Tripartite Motif Containing 32 (TRIM32) antibody

anti-Tripartite Motif Containing 32 (TRIM32) antibody (Image 2)

Publications

Product: Chiang, Beck, Yen et al.: "Homozygosity mapping with SNP arrays identifies TRIM32, an E3 ubiquitin ligase, as a Bardet-Biedl syndrome gene (BBS11)." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 16, pp. 6287-92, 2006 (PubMed).