GTF2I Repeat Domain Containing 1 (GTF2IRD1) antibody

Antigen: GTF2I Repeat Domain Containing 1 (GTF2IRD1)

Synonyms: BEN, WBS, GTF3, RBAP2, CREAM1, MUSTRD1, WBSCR11, WBSCR12, hMusTRD1alpha1, ESTM9, Cream1, Gtf2il, X83320, MusTRD1, MGC102438, 1700012P16Rik, Tg(Alb1-Myc)166.8Sst, Gtf3, GTF2IRD1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Dog (Canine)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN309938

Additional Information

Alternative name: GTF2IRD1 / CREAM1

Gene ID: GTF2IRD1

UniProt: Q9UHL9

Immunogen: The immunogen for anti-GTF2IRD1 antibody: synthetic peptide directed towards the N terminal of human GTF2IRD1

Sequence: MALLGKRCDVPTNGCGPDRWNSAFTRKDEIITSLVSALDS MCSALSKLNA

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-GTF2IRD1 antibody concentration is 1 mg/ml.

Description: GTF2IRD1 contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptional regulator under the control of Retinoblastoma protein. GTF2IRD1 is related to Williams-Beuren syndrome, a multisystem developmental disorder. Western blots using three different antibodies against three unique regions of this protein target confirm the same apparent molecular weight in our tests. The protein encoded by this gene contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptional regulator under the control of Retinoblastoma protein. This gene is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by deletion of multiple genes at 7q11.23. Alternative splicing of this gene generates at least 2 transcript variants.

Characteristics: Antigen Size: 959 amino acids

Molecular Weight: 106kDa

Application Details

Application Notes: WB Suggested Anti-GTF2IRD1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-GTF2IRD1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T

anti-GTF2I Repeat Domain Containing 1 (GTF2IRD1) antibody (Image 2)

Publications

Product: Tassabehji, Hammond, Karmiloff-Smith et al.: "GTF2IRD1 in craniofacial development of humans and mice." in: Science (New York, N.Y.), Vol. 310, Issue 5751, pp. 1184-7, 2005 (PubMed).