Death Inducer-Obliterator 1 (DIDO1) antibody

Antigen: Death Inducer-Obliterator 1 (DIDO1)

Synonyms: BYE1, DIO1, DATF1, DIDO2, DIDO3, DIO-1, FLJ11265, KIAA0333, MGC16140, C20orf158, dJ885L7.8, DKFZp434P1115, Datf1, Dido2, Dido3, mKIAA0333, C530043I07, 6720461J16Rik, D130048F08Rik, DIDO1, MGC137821, datf1l, fi35b04, MGC158157, wu:fi35b04, zgc:158157, DKFZp469J1523, bye1, dio1, datf1, dido2, dido3, dio-1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Dog (Canine), Xenopus laevis, Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN309949

Additional Information

Alternative name: DIDO1

Gene ID: DIDO1

UniProt: Q9BTC0

Immunogen: The immunogen for anti-DIDO1 antibody: synthetic peptide directed towards the C terminal of human DIDO1

Sequence: KKAVVVPARSEALGKEAACESSTPSWASDHNYNAVKPEKT AAPSPSLLYK

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-DIDO1 antibody concentration is 1 mg/ml.

Description: In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. DIDO1 gene is similar to the mouse gene and therefore is thought to be involved in apoptosis.Apoptosis, a major form of cell death, is an efficient mechanism for eliminating unwanted cells and is of central importance for development and homeostasis in metazoan animals. In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. This gene is similar to the mouse gene and therefore is thought to be involved in apoptosis. Alternatively spliced transcripts have been found for this gene, encoding multiple isoforms.Apoptosis, a major form of cell death, is an efficient mechanism for eliminating unwanted cells and is of central importance for development and homeostasis in metazoan animals. In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. This gene is similar to the mouse gene and therefore is thought to be involved in apoptosis. Alternatively spliced transcripts have been found for this gene, encoding multiple isoforms.

Characteristics: Antigen Size: 562 amino acids

Molecular Weight: 61kDa

Synonyms: BYE1, DIO1, DATF1, DIDO2, DIDO3, DIO-1, FLJ11265, KIAA0333, MGC16140, C20orf158, dJ885L7.8, DKFZp434P1115, Datf1, Dido2, Dido3, mKIAA0333, C530043I07, 6720461J16Rik, D130048F08Rik, DIDO1, MGC137821, datf1l, fi35b04, MGC158157, wu:fi35b04, zgc:158157, DKFZp469J1523, bye1, dio1, datf1, dido2, dido3, dio-1

Application Details

Application Notes: WB Suggested Anti-DIDO1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-DIDO1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T

Publications

Product: Trachana, van Wely, Guerrero et al.: "Dido disruption leads to centrosome amplification and mitotic checkpoint defects compromising chromosome stability." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 104, Issue 8, pp. 2691-6, 2007 (PubMed).