Single Stranded DNA Binding Protein 4 (SSBP4) antibody

Antigen: Single Stranded DNA Binding Protein 4 (SSBP4)

Synonyms: MGC3181, Sspb4, AW743380, 1210002E11Rik, D55, ssbp, wu:fb33f07, si:ch211-202n20.1, SSBP4, MGC128808

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Zebrafish, Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN309967

Additional Information

Alternative name: SSBP4

Gene ID: SSBP4

UniProt: Q9BWW5

Immunogen: The immunogen for anti-SSBP4 antibody: synthetic peptide directed towards the C terminal of human SSBP4

Sequence: DGLPKSSPGAVAGLSNAPGTPRDDGEMAAAGTFLHPFPSE SYSPGMTMSV

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SSBP4 antibody concentration is 1 mg/ml.

Description: SSBP4 contains 1 LisH domain. The exact function of SSBP4 remains unknown.

Characteristics: Antigen Size: 363 amino acids

Molecular Weight: 37kDa

Application Details

Application Notes: WB Suggested Anti-SSBP4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Chromatin Binding Proteins

Restrictions: For Research Use only

Images

WB Suggested Anti-SSBP4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T

Publications

Product: Ballif, Villén, Beausoleil et al.: "Phosphoproteomic analysis of the developing mouse brain." in: Molecular & cellular proteomics : MCP, Vol. 3, Issue 11, pp. 1093-101, 2004 (PubMed).