Heterogeneous Nuclear Ribonucleoprotein M (HNRNPM) antibody

Antigen: Heterogeneous Nuclear Ribonucleoprotein M (HNRNPM)

Synonyms: HNRPM, HTGR1, NAGR1, HNRPM4, HNRNPM4, DKFZp547H118, Hnrpm, AA409009, KIAA4193, mKIAA4193, 2610023M21Rik, Hnrnpm, Hnrpm4, MGC109545, HNRNPM, fa10g07, wu:fa10g07, wu:fa98b02, si:ch211-197g15.1, hnrpm, cg9373, CG9373, DmelCG9373, hnRNP M, hrp59, Hrp59, p75

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN310054

Additional Information

Alternative name: HnRNP-M / HNRNPM

Gene ID: HNRPM

UniProt: P52272

Immunogen: The immunogen for anti-HNRPM antibody: synthetic peptide directed towards the N terminal of human HNRPM

Sequence: ATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEK NIKRGGNRFE

Cross-Reactivity: Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-HNRPM antibody concentration is 1 mg/ml.

Description: HNRPM belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. HNRPM has three repeats of quasi-RRM domains that bind to RNAs. HNRPM also constitutes a monomer of the N-acetylglucosamine-specific receptor which is postulated to trigger selective recycling of immature GlcNAc-bearing thyroglobulin molecules.This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs. This protein also constitutes a monomer of the N-acetylglucosamine-specific receptor which is postulated to trigger selective recycling of immature GlcNAc-bearing thyroglobulin molecules. Multiple alternatively spliced transcript variants are known for this gene but only two transcripts has been isolated.

Characteristics: Antigen Size: 691 amino acids

Molecular Weight: 73kDa

Synonyms: HNRPM, HTGR1, NAGR1, HNRPM4, HNRNPM4, DKFZp547H118, Hnrpm, AA409009, KIAA4193, mKIAA4193, 2610023M21Rik, Hnrnpm, Hnrpm4, MGC109545, HNRNPM, fa10g07, wu:fa10g07, wu:fa98b02, si:ch211-197g15.1, hnrpm, cg9373, CG9373, DmelCG9373, hnRNP M, hrp59, Hrp59, p75

Application Details

Application Notes: WB Suggested Anti-HNRPM Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-HNRPM Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).