Splicing Factor 3B, 14 KDa Subunit (SF3B14) antibody

Antigen: Splicing Factor 3B, 14 KDa Subunit (SF3B14)

Synonyms: SF3B14, P14, Ht006, SAP14, CGI-110, HSPC175, SF3B14a, MGC68842, MGC137400

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Xenopus laevis, Zebrafish, Dog (Canine), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN310082

Additional Information

Alternative name: SF3B14 / SAP14

Gene ID: SF3B14

UniProt: Q7RTV0

Immunogen: The immunogen for anti-SF3B14 antibody: synthetic peptide directed towards the middle region of human SF3B14

Sequence: HLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKE KYGINTDPPK

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SF3B14 antibody concentration is 1 mg/ml.

Description: SF3B14 is a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. SF3B14 also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site.This gene encodes a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. This 14 kDa protein also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site.

Characteristics: Antigen Size: 125 amino acids

Molecular Weight: 14kDa

Application Details

Application Notes: WB Suggested Anti-SF3B14 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Placenta.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SF3B14 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Placenta

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).