Spermatid Perinuclear RNA Binding Protein (STRBP) antibody

Antigen: Spermatid Perinuclear RNA Binding Protein (STRBP)

Synonyms: p74, SPNR, ILF3L, MGC3405, FLJ11307, FLJ14223, FLJ14984, FLJ21960, MGC21529, DKFZp434N214

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Dog (Canine), Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN310090

Additional Information

Alternative name: STRBP / SPNR

Gene ID: STRBP

UniProt: Q96SI9

Immunogen: The immunogen for anti-STRBP antibody: synthetic peptide directed towards the middle region of human STRBP

Sequence: PSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNE SKNETVSSNS

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-STRBP antibody concentration is 1 mg/ml.

Description: STRBP contains 2 DRBM (double-stranded RNA-binding) domains and 1 DZF domain. STRBP is involved in spermatogenesis and sperm function. It plays a role in regulation of cell growth.

Characteristics: Antigen Size: 672 amino acids

Molecular Weight: 74kDa

Application Details

Application Notes: WB Suggested Anti-STRBP Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-STRBP Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T

Publications

Product: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).